PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013590461.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 370aa    MW: 41768.5 Da    PI: 6.5573
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013590461.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.18.3e-1858105148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd++l+ +v+ +G g W+t + + g++R++k+c++rw +yl
   XP_013590461.1  58 KGAWTQEEDQKLIAYVQHHGEGGWRTLPDKAGLKRCGKSCRLRWANYL 105
                      79********************************************97 PP

2Myb_DNA-binding57.92.3e-18111155147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg +++eE++ ++++++ +G++ W++Iar+++ gRt++++k++w+++
   XP_013590461.1 111 RGEFSQEEEDSIINLHAIHGNK-WSAIARRLP-GRTDNEIKNHWNTH 155
                      899*******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.1E-2449108IPR009057Homeodomain-like
PROSITE profilePS5129417.78353105IPR017930Myb domain
SuperFamilySSF466895.24E-3055152IPR009057Homeodomain-like
SMARTSM007173.4E-1357107IPR001005SANT/Myb domain
PfamPF002491.1E-1558105IPR001005SANT/Myb domain
CDDcd001678.58E-1060105No hitNo description
PROSITE profilePS5129426.611106160IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-26109161IPR009057Homeodomain-like
SMARTSM007174.0E-17110158IPR001005SANT/Myb domain
PfamPF002492.3E-16111155IPR001005SANT/Myb domain
CDDcd001671.45E-12113156No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009625Biological Processresponse to insect
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MFSSKDHVLS FFDLSPDHNK KSLFFLLSLF FSFSSFYCNN QKSRMVRTPC CRAEGLKKGA  60
WTQEEDQKLI AYVQHHGEGG WRTLPDKAGL KRCGKSCRLR WANYLRPDIK RGEFSQEEED  120
SIINLHAIHG NKWSAIARRL PGRTDNEIKN HWNTHIKKRL IKKGIDPLTH KSLDHSETLP  180
DKSIGHQEDD DQKSNNKKSL GPSSARFLNR VANIFGKRLD HSALSDIIGS GGPFTTHTTP  240
TTSASECEKS TSSLSTPNSS NLHMIHDATS LSSSTFSNDT SAQLVYDNIF DDVEDMTGFS  300
SRFLNDIVSH DDEDLLMLDE SSSDNTLFMK ELTMILKGDK TETMSFNDSH LAAINVVDDY  360
SFEGIDNWFG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-29561605108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894000.0AC189400.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB056L15, complete sequence.
GenBankFJ5843000.0FJ584300.1 Brassica rapa subsp. pekinensis MYB domain protein 122 pseudogene, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013590461.10.0PREDICTED: transcription factor MYB122-like
SwissprotQ9C9C81e-153MY122_ARATH; Transcription factor MYB122
TrEMBLA0A0D3D0J00.0A0A0D3D0J0_BRAOL; Uncharacterized protein
STRINGBra015939.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74080.11e-137myb domain protein 122